PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g076850.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 164aa    MW: 18220.4 Da    PI: 8.0572
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g076850.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.81.2e-3851108259
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                         ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k
  Sopim02g076850.0.1  51 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 108
                         68999***************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2950108IPR003851Zinc finger, Dof-type
PfamPF027014.0E-3253108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.25855109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1902455Biological Processnegative regulation of stem cell population maintenance
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MAEVQESPIS QGIKLFGATI QIQEKQAKAT HQPTNKVVVD DDDDNDQEKR PDKIIPCPRC  60
KSMETKFCYF NNYNVNQPRH FCKGCQRYWT AGGALRNVPV GAGRRKAKPP CGPGPHGDLA  120
DGCNLFDVAN QLDFDGSVVA HEDQWHLFPA AKRRRSTSDS QSY*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2153880.0AC215388.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0122E16, complete sequence.
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316809.11e-121PREDICTED: dof zinc finger protein DOF1.5
SwissprotO229672e-52CDF4_ARATH; Cyclic dof factor 4
TrEMBLK4B8R21e-121K4B8R2_SOLLC; Uncharacterized protein
STRINGSolyc02g076850.1.11e-120(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72402232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.11e-51Dof family protein